![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (10 species) not a true protein |
![]() | Species Pseudomonas aeruginosa [TaxId:208963] [187700] (1 PDB entry) |
![]() | Domain d2fe7b_: 2fe7 B: [133326] Other proteins in same PDB: d2fe7a1 automated match to d2fe7a1 |
PDB Entry: 2fe7 (more details), 2 Å
SCOPe Domain Sequences for d2fe7b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe7b_ d.108.1.1 (B:) automated matches {Pseudomonas aeruginosa [TaxId: 208963]} enlyfqghmtleirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptr almclsegrpigyavffysystwlgrngiyledlyvtpeyrgvgagrrllrelareavan dcgrlewsvldwnqpaidfyrsigalpqdewvryrldgealrkmae
Timeline for d2fe7b_: