Lineage for d2fe7b2 (2fe7 B:1-158)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2968378Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2968379Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (12 families) (S)
  5. 2968380Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2968734Protein automated matches [190241] (13 species)
    not a true protein
  7. 2968806Species Pseudomonas aeruginosa [TaxId:208963] [187700] (1 PDB entry)
  8. 2968807Domain d2fe7b2: 2fe7 B:1-158 [133326]
    Other proteins in same PDB: d2fe7a1, d2fe7b3
    automated match to d2fe7a1

Details for d2fe7b2

PDB Entry: 2fe7 (more details), 2 Å

PDB Description: the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa
PDB Compounds: (B:) probable N-acetyltransferase

SCOPe Domain Sequences for d2fe7b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe7b2 d.108.1.1 (B:1-158) automated matches {Pseudomonas aeruginosa [TaxId: 208963]}
mtleirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptralmclseg
rpigyavffysystwlgrngiyledlyvtpeyrgvgagrrllrelareavandcgrlews
vldwnqpaidfyrsigalpqdewvryrldgealrkmae

SCOPe Domain Coordinates for d2fe7b2:

Click to download the PDB-style file with coordinates for d2fe7b2.
(The format of our PDB-style files is described here.)

Timeline for d2fe7b2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2fe7b3
View in 3D
Domains from other chains:
(mouse over for more information)
d2fe7a1