Lineage for d2fe7a1 (2fe7 A:3-158)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1037211Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 1037212Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 1037213Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 1037468Protein Probable N-acetyltransferase PA0478 [143676] (1 species)
  7. 1037469Species Pseudomonas aeruginosa [TaxId:287] [143677] (1 PDB entry)
    Uniprot Q9I640 3-158
  8. 1037470Domain d2fe7a1: 2fe7 A:3-158 [133325]
    Other proteins in same PDB: d2fe7b_

Details for d2fe7a1

PDB Entry: 2fe7 (more details), 2 Å

PDB Description: the crystal structure of a probable n-acetyltransferase from pseudomonas aeruginosa
PDB Compounds: (A:) probable N-acetyltransferase

SCOPe Domain Sequences for d2fe7a1:

Sequence, based on SEQRES records: (download)

>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}
leirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptralmclsegrp
igyavffysystwlgrngiyledlyvtpeyrgvgagrrllrelareavandcgrlewsvl
dwnqpaidfyrsigalpqdewvryrldgealrkmae

Sequence, based on observed residues (ATOM records): (download)

>d2fe7a1 d.108.1.1 (A:3-158) Probable N-acetyltransferase PA0478 {Pseudomonas aeruginosa [TaxId: 287]}
leirpavpadaeqilafiieladyerarhevvtdvegirrslfaegsptralmclsegrp
igyavffysystwlgrngiyledlyvtpeyrgagrrllrelareavandcgrlewsvldw
nqpaidfyrsigalpqdewvryrldgealrkmae

SCOPe Domain Coordinates for d2fe7a1:

Click to download the PDB-style file with coordinates for d2fe7a1.
(The format of our PDB-style files is described here.)

Timeline for d2fe7a1:

View in 3D
Domains from other chains:
(mouse over for more information)
d2fe7b_