SCOPe 2.05: Domain d2fe1a1: 2fe1 A:1-130

Lineage for d2fe1a1 (2fe1 A:1-130)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.120: PIN domain-like [88722] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145

4. Superfamily c.120.1: PIN domain-like [88723] (3 families)

5. Family c.120.1.1: PIN domain [89619] (7 proteins)
   Pfam PF01850

6. Protein Conserved hypothetical protein PAE0151 [142114] (1 species)

7. Species Pyrobaculum aerophilum [TaxId:13773] [142115] (1 PDB entry)
   Uniprot Q8ZZP3 1-130

8. Domain d2fe1a1: 2fe1 A:1-130 [133322]
   complexed with ca, cl, mn

Details for d2fe1a1

PDB Entry: 2fe1, 2.2 Å

PDB Description: crystal structure of pae0151 from pyrobaculum aerophilum

PDB Compounds: (A:) conserved hypothetical protein PAE0151

SCOPe Domain Sequences for d2fe1a1:

Sequence; same for both SEQRES and ATOM records:

>d2fe1a1 c.120.1.1 (A:1-130) Conserved hypothetical protein PAE0151 {Pyrobaculum aerophilum [TaxId: 13773]}
melvvdasaiaalyvpeerseqaeravsqaqelhtldlaayevandlwkharrgllrede
asnmleelweffkalkvhsyaevlkdafalalkhgvtvydaayvalaekiggklltldrq
laekfpalvt

Timeline for d2fe1a1:

• d2fe1a1 first appeared in SCOP 1.73
  
• d2fe1a1 appears in SCOPe 2.04
  
• d2fe1a1 appears in SCOPe 2.06
  
• d2fe1a1 appears in the current release, SCOPe 2.08