Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.120: PIN domain-like [88722] (1 superfamily) 3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145 |
Superfamily c.120.1: PIN domain-like [88723] (3 families) |
Family c.120.1.1: PIN domain [89619] (7 proteins) Pfam PF01850 |
Protein Conserved hypothetical protein PAE0151 [142114] (1 species) |
Species Pyrobaculum aerophilum [TaxId:13773] [142115] (1 PDB entry) Uniprot Q8ZZP3 1-130 |
Domain d2fe1a1: 2fe1 A:1-130 [133322] complexed with ca, cl, mn |
PDB Entry: 2fe1 (more details), 2.2 Å
SCOPe Domain Sequences for d2fe1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fe1a1 c.120.1.1 (A:1-130) Conserved hypothetical protein PAE0151 {Pyrobaculum aerophilum [TaxId: 13773]} melvvdasaiaalyvpeerseqaeravsqaqelhtldlaayevandlwkharrgllrede asnmleelweffkalkvhsyaevlkdafalalkhgvtvydaayvalaekiggklltldrq laekfpalvt
Timeline for d2fe1a1: