Lineage for d2fe1a1 (2fe1 A:1-130)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2921858Fold c.120: PIN domain-like [88722] (1 superfamily)
    3 layers, a/b/a; core: parallel beta-sheet of 5 strands, order 32145
  4. 2921859Superfamily c.120.1: PIN domain-like [88723] (4 families) (S)
  5. 2921860Family c.120.1.1: PIN domain [89619] (7 proteins)
    Pfam PF01850
  6. 2921861Protein Conserved hypothetical protein PAE0151 [142114] (1 species)
  7. 2921862Species Pyrobaculum aerophilum [TaxId:13773] [142115] (1 PDB entry)
    Uniprot Q8ZZP3 1-130
  8. 2921863Domain d2fe1a1: 2fe1 A:1-130 [133322]
    complexed with ca, cl, mn

Details for d2fe1a1

PDB Entry: 2fe1 (more details), 2.2 Å

PDB Description: crystal structure of pae0151 from pyrobaculum aerophilum
PDB Compounds: (A:) conserved hypothetical protein PAE0151

SCOPe Domain Sequences for d2fe1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fe1a1 c.120.1.1 (A:1-130) Conserved hypothetical protein PAE0151 {Pyrobaculum aerophilum [TaxId: 13773]}
melvvdasaiaalyvpeerseqaeravsqaqelhtldlaayevandlwkharrgllrede
asnmleelweffkalkvhsyaevlkdafalalkhgvtvydaayvalaekiggklltldrq
laekfpalvt

SCOPe Domain Coordinates for d2fe1a1:

Click to download the PDB-style file with coordinates for d2fe1a1.
(The format of our PDB-style files is described here.)

Timeline for d2fe1a1: