Class k: Designed proteins [58788] (44 folds) |
Fold k.45: Ubiquitin [144344] (1 superfamily) |
Superfamily k.45.1: Ubiquitin [144345] (1 family) |
Family k.45.1.1: Ubiquitin [144346] (1 protein) |
Protein Ubiquitin [144347] (4 species) |
Species Synthetic [144348] (6 PDB entries) |
Domain d2fcsb1: 2fcs B:1-71 [133281] automatically matched to 1YJ1 A:1-71 complexed with act, cd, so4 |
PDB Entry: 2fcs (more details), 1.8 Å
SCOPe Domain Sequences for d2fcsb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fcsb1 k.45.1.1 (B:1-71) Ubiquitin {Synthetic} lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdyn iqkestlhlvl
Timeline for d2fcsb1: