Lineage for d2fcsb1 (2fcs B:1-71)

  1. Root: SCOPe 2.01
  2. 1074148Class k: Designed proteins [58788] (44 folds)
  3. 1074884Fold k.45: Ubiquitin [144344] (1 superfamily)
  4. 1074885Superfamily k.45.1: Ubiquitin [144345] (1 family) (S)
  5. 1074886Family k.45.1.1: Ubiquitin [144346] (1 protein)
  6. 1074887Protein Ubiquitin [144347] (4 species)
  7. 1074894Species Synthetic [144348] (6 PDB entries)
  8. 1074902Domain d2fcsb1: 2fcs B:1-71 [133281]
    automatically matched to 1YJ1 A:1-71
    complexed with act, cd, so4

Details for d2fcsb1

PDB Entry: 2fcs (more details), 1.8 Å

PDB Description: x-ray crystal structure of a chemically synthesized [l-gln35]ubiquitin with a cubic space group
PDB Compounds: (B:) Ubiquitin

SCOPe Domain Sequences for d2fcsb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fcsb1 k.45.1.1 (B:1-71) Ubiquitin {Synthetic}
lqifvktltgktitlevepsdtienvkakiqdkeqippdqqrlifagkqledgrtlsdyn
iqkestlhlvl

SCOPe Domain Coordinates for d2fcsb1:

Click to download the PDB-style file with coordinates for d2fcsb1.
(The format of our PDB-style files is described here.)

Timeline for d2fcsb1: