![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily) unusual fold |
![]() | Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) ![]() automatically mapped to Pfam PF02898 |
![]() | Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins) |
![]() | Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [82822] (5 PDB entries) |
![]() | Domain d2fc1a2: 2fc1 A:2-359 [133261] Other proteins in same PDB: d2fc1a3 automated match to d1m7va_ complexed with arg, hbi, hem, no missing some secondary structures that made up less than one-third of the common domain |
PDB Entry: 2fc1 (more details), 2 Å
SCOPe Domain Sequences for d2fc1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fc1a2 d.174.1.1 (A:2-359) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]} ilwneakafiaecyqelgkeeevkdrldsikseidrtgsyvhtkeelehgakmawrnsnr cigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekgekqvei wnhqliryagyegerigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqpvwyel prslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgteigar nladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdhhtaas qfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkpye
Timeline for d2fc1a2: