Lineage for d2fc1a_ (2fc1 A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2609056Fold d.174: Nitric oxide (NO) synthase oxygenase domain [56511] (1 superfamily)
    unusual fold
  4. 2609057Superfamily d.174.1: Nitric oxide (NO) synthase oxygenase domain [56512] (1 family) (S)
    automatically mapped to Pfam PF02898
  5. 2609058Family d.174.1.1: Nitric oxide (NO) synthase oxygenase domain [56513] (2 proteins)
  6. 2609059Protein Nitric oxide (NO) synthase oxygenase domain [56514] (6 species)
  7. 2609060Species Bacillus subtilis [TaxId:1423] [82822] (5 PDB entries)
  8. 2609063Domain d2fc1a_: 2fc1 A: [133261]
    automated match to d1m7va_
    complexed with arg, hbi, hem, no

Details for d2fc1a_

PDB Entry: 2fc1 (more details), 2 Å

PDB Description: Heme NO Complex in NOS
PDB Compounds: (A:) nitric oxide synthase

SCOPe Domain Sequences for d2fc1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fc1a_ d.174.1.1 (A:) Nitric oxide (NO) synthase oxygenase domain {Bacillus subtilis [TaxId: 1423]}
gshmeilwneakafiaecyqelgkeeevkdrldsikseidrtgsyvhtkeelehgakmaw
rnsnrcigrlfwnslnvidrrdvrtkedvrdalfhhietatnngkirpsitifppeekge
kqveiwnhqliryagyegerigdpasrsltaaceqlgwrgertdfdllplifrmrgdeqp
vwyelprslvievpithpdieafsdlelkwygvpiisdmklevggihynaapfngwymgt
eigarnladekrydklkkvasvigistnyntdlwkdqalvelnkavlysykkqgvsivdh
htaasqfkrfeeqeeeagrkltgdwtwlippispaathifhrsydnsivkpnyfyqdkpy
e

SCOPe Domain Coordinates for d2fc1a_:

Click to download the PDB-style file with coordinates for d2fc1a_.
(The format of our PDB-style files is described here.)

Timeline for d2fc1a_: