Lineage for d2facb_ (2fac B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1266817Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1266818Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1266819Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1266824Protein Acyl carrier protein [47338] (6 species)
  7. 1266830Species Escherichia coli [TaxId:562] [47339] (11 PDB entries)
    Uniprot P02901
  8. 1266836Domain d2facb_: 2fac B: [133190]
    automated match to d1acp__
    complexed with pm4, zn

Details for d2facb_

PDB Entry: 2fac (more details), 1.76 Å

PDB Description: Crystal structure of E. coli hexanoyl-ACP
PDB Compounds: (B:) Acyl carrier protein

SCOPe Domain Sequences for d2facb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2facb_ a.28.1.1 (B:) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghqa

SCOPe Domain Coordinates for d2facb_:

Click to download the PDB-style file with coordinates for d2facb_.
(The format of our PDB-style files is described here.)

Timeline for d2facb_: