Lineage for d2facb1 (2fac B:1-76)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 639734Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 639735Superfamily a.28.1: ACP-like [47336] (3 families) (S)
  5. 639736Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (5 proteins)
  6. 639741Protein Acyl carrier protein [47338] (4 species)
  7. 639747Species Escherichia coli [TaxId:562] [47339] (8 PDB entries)
  8. 639755Domain d2facb1: 2fac B:1-76 [133190]
    automatically matched to d1acp__
    complexed with pm4, zn

Details for d2facb1

PDB Entry: 2fac (more details), 1.76 Å

PDB Description: Crystal structure of E. coli hexanoyl-ACP
PDB Compounds: (B:) Acyl carrier protein

SCOP Domain Sequences for d2facb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2facb1 a.28.1.1 (B:1-76) Acyl carrier protein {Escherichia coli [TaxId: 562]}
stieervkkiigeqlgvkqeevtnnasfvedlgadsldtvelvmaleeefdteipdeeae
kittvqaaidyinghq

SCOP Domain Coordinates for d2facb1:

Click to download the PDB-style file with coordinates for d2facb1.
(The format of our PDB-style files is described here.)

Timeline for d2facb1: