SCOPe 2.08: Domain d2f9ca1: 2f9c A:3-322

Lineage for d2f9ca1 (2f9c A:3-322)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.81: Single-stranded left-handed beta-helix [51160] (4 superfamilies)
   superhelix turns are made of parallel beta-strands and (short) turns

4. Superfamily b.81.1: Trimeric LpxA-like enzymes [51161] (9 families)
   superhelical turns are made of three short strands; duplication: the sequence hexapeptide repeats correspond to individual strands

5. Family b.81.1.7: YdcK-like [141583] (2 proteins)
   part of Pfam PF00132
   this is a repeat family; one repeat unit is 2f9c A:267-285 found in domain

6. Protein Hypothetical protein YdcK [141584] (1 species)

7. Species Salmonella enterica [TaxId:28901] [141585] (1 PDB entry)
   Uniprot Q5PHU6 3-322

8. Domain d2f9ca1: 2f9c A:3-322 [133158]
   Other proteins in same PDB: d2f9cb1, d2f9cb2
   complexed with cs

Details for d2f9ca1

PDB Entry: 2f9c, 2.8 Å

PDB Description: Crystal structure of YDCK from Salmonella cholerae. NESG target SCR6

PDB Compounds: (A:) Hypothetical protein YDCK

SCOPe Domain Sequences for d2f9ca1:

Sequence; same for both SEQRES and ATOM records:

>d2f9ca1 b.81.1.7 (A:3-322) Hypothetical protein YdcK {Salmonella enterica [TaxId: 28901]}
kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi
ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg
ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt
ihlrgpkvingedritrtpl

Timeline for d2f9ca1:

• d2f9ca1 first appeared in SCOP 1.73
  
• d2f9ca1 appears in SCOPe 2.07