PDB entry 2f9c

View 2f9c on RCSB PDB site
Description: Crystal structure of YDCK from Salmonella cholerae. NESG target SCR6
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, PSI, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG
Deposited on 2005-12-05, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.253
AEROSPACI score: 0.15 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hypothetical protein YDCK
    Species: Salmonella enterica [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
    • GB YP_150522
    Domains in SCOPe 2.07: d2f9ca1
  • Chain 'B':
    Compound: Hypothetical protein YDCK
    Species: Salmonella enterica [TaxId:28901]
    Database cross-references and differences (RAF-indexed):
    • GB YP_150522 (Start-325)
      • expression tag (326-329)
    Domains in SCOPe 2.07: d2f9cb1, d2f9cb2
  • Heterogens: CS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2f9cA (A:)
    mtkyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcw
    iydenamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssv
    reecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatitha
    fiehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehali
    egncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdd
    ntihlrgpkvingedritrtplvgsllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9cA (A:)
    kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
    denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
    ecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatithafi
    ehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehalieg
    ncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddnt
    ihlrgpkvingedritrtpl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2f9cB (B:)
    mtkyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcw
    iydenamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssv
    reecaiygdarvlnqseilaiqglthehaqilqiydratvnhsrivhqvqlygnatitha
    fiehraevfdfaliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehali
    egncvlkhhvlvgghaevrggpillddrvlieghaciqgeilierqveisgraaviafdd
    ntihlrgpkvingedritrtplvgsllehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f9cB (B:)
    kyrlsegpraftyqvdgekksvllrqviavtdfndvkagtsggwvdadnvlsqqgdcwiy
    denamafagteitgnaritqpctlynnvrigdnvwidradisdgarisdnvtiqsssvre
    ecaiygdarvlnqseilaiilqiydratvnhsrivhqvqlygnatithafiehraevfdf
    aliegdkdnnvwicdcakvygharviagteedaiptlryssqvaehaliegncvlkhhvl
    vgghaevrggpillddrvlieghaciqgeilierqveisgraaviafddntihlrgpkvi
    ngedritrtplvgsllehh