| Class c: Alpha and beta proteins (a/b) [51349] (141 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (22 families) ![]() |
| Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins) |
| Protein Class alpha GST [81360] (8 species) |
| Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (8 PDB entries) |
| Domain d2f8fb2: 2f8f B:4-84 [133125] Other proteins in same PDB: d2f8fa1, d2f8fb1 automatically matched to d1oe8b2 complexed with gtt; mutant |
PDB Entry: 2f8f (more details), 2.1 Å
SCOP Domain Sequences for d2f8fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f8fb2 c.47.1.5 (B:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm
Timeline for d2f8fb2: