SCOP 1.73: Domain d2f8fb2: 2f8f B:4-84

Lineage for d2f8fb2 (2f8f B:4-84)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (22 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (18 proteins)

6. Protein Class alpha GST [81360] (8 species)

7. Species Blood fluke (Schistosoma haematobium) [TaxId:6185] [89704] (8 PDB entries)

8. Domain d2f8fb2: 2f8f B:4-84 [133125]
   Other proteins in same PDB: d2f8fa1, d2f8fb1
   automatically matched to d1oe8b2
   complexed with gtt; mutant

Details for d2f8fb2

PDB Entry: 2f8f, 2.1 Å

PDB Description: crystal structure of the y10f mutant of the gluathione s-transferase from schistosoma haematobium

PDB Compounds: (B:) glutathione s-transferase 28 kda

SCOP Domain Sequences for d2f8fb2:

Sequence; same for both SEQRES and ATOM records:

>d2f8fb2 c.47.1.5 (B:4-84) Class alpha GST {Blood fluke (Schistosoma haematobium) [TaxId: 6185]}
dhikviffngrgraesirmtlvaagvnyederisfqdwpkikptipggrlpavkitdnhg
hvkwmveslaiarymakkhhm

Timeline for d2f8fb2:

• d2f8fb2 is new in SCOP 1.73
  
• d2f8fb2 appears in SCOP 1.75
  
• d2f8fb2 appears in the current release, SCOPe 2.08