SCOPe 2.05: Domain d2f7ze_: 2f7z E:

Lineage for d2f7ze_ (2f7z E:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein cAMP-dependent PK, catalytic subunit [56116] (5 species)
   AGC group; PKA subfamily; serine/threonine kinase

7. Species Cow (Bos taurus) [TaxId:9913] [56118] (40 PDB entries)
   Uniprot P00517

8. Domain d2f7ze_: 2f7z E: [133113]
   automated match to d3qame_
   complexed with 6ea

Details for d2f7ze_

PDB Entry: 2f7z, 3 Å

PDB Description: Protein Kinase A bound to (R)-1-(1H-Indol-3-ylmethyl)-2-(2-pyridin-4-yl-[1,7]naphtyridin-5-yloxy)-ehylamine

PDB Compounds: (E:) cAMP-dependent protein kinase, alpha-catalytic subunit

SCOPe Domain Sequences for d2f7ze_:

Sequence; same for both SEQRES and ATOM records:

>d2f7ze_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Cow (Bos taurus) [TaxId: 9913]}
vkeflakakedflkkwenpaqntahldqferiktlgtgsfgrvmlvkhmetgnhyamkil
dkqkvvklkqiehtlnekrilqavnfpflvklefsfkdnsnlymvmeyvpggemfshlrr
igrfsepharfyaaqivltfeylhsldliyrdlkpenllidqqgyiqvtdfgfakrvkgr
twtlcgtpeylapeiilskgynkavdwwalgvliyemaagyppffadqpiqiyekivsgk
vrfpshfssdlkdllrnllqvdltkrfgnlkngvndiknhkwfattdwiaiyqrkveapf
ipkfkgpgdtsnfddyeeeeirvsinekcgkefsef

Timeline for d2f7ze_:

• d2f7ze_ first appeared in SCOP 1.73, called d2f7ze1
  
• d2f7ze_ appears in SCOPe 2.04
  
• d2f7ze_ appears in SCOPe 2.06
  
• d2f7ze_ appears in the current release, SCOPe 2.08