SCOP 1.73: Domain d2f7oa2: 2f7o A:523-1044

Lineage for d2f7oa2 (2f7o A:523-1044)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.30: Supersandwich [49993] (3 superfamilies)
   sandwich; 18 strands in 2 sheets

4. Superfamily b.30.5: Galactose mutarotase-like [74650] (11 families)
   probable carbohydrate-binding domain in enzymes acting on sugars

5. Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 proteins)
   family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
   the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains

6. Protein Golgi alpha-mannosidase II [88657] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (23 PDB entries)

8. Domain d2f7oa2: 2f7o A:523-1044 [133093]
   Other proteins in same PDB: d2f7oa1, d2f7oa3
   automatically matched to d1htya2
   complexed with mpd, msn, nag, po4, zn

Details for d2f7oa2

PDB Entry: 2f7o, 1.43 Å

PDB Description: golgi alpha-mannosidase ii complex with mannostatin a

PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d2f7oa2:

Sequence; same for both SEQRES and ATOM records:

>d2f7oa2 b.30.5.6 (A:523-1044) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshs

Timeline for d2f7oa2:

• d2f7oa2 is new in SCOP 1.73
  
• d2f7oa2 appears in SCOP 1.75
  
• d2f7oa2 appears in the current release, SCOPe 2.08