Lineage for d2f7oa1 (2f7o A:412-522)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 636923Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 636966Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) (S)
  5. 636967Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 636968Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. 636969Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (23 PDB entries)
  8. 636980Domain d2f7oa1: 2f7o A:412-522 [133092]
    Other proteins in same PDB: d2f7oa2, d2f7oa3
    automatically matched to d1htya1
    complexed with mpd, msn, nag, po4, zn

Details for d2f7oa1

PDB Entry: 2f7o (more details), 1.43 Å

PDB Description: golgi alpha-mannosidase ii complex with mannostatin a
PDB Compounds: (A:) Alpha-mannosidase II

SCOP Domain Sequences for d2f7oa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f7oa1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOP Domain Coordinates for d2f7oa1:

Click to download the PDB-style file with coordinates for d2f7oa1.
(The format of our PDB-style files is described here.)

Timeline for d2f7oa1: