![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (10 superfamilies) 3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold |
![]() | Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (3 families) ![]() |
![]() | Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins) family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family |
![]() | Protein Golgi alpha-mannosidase II [88694] (1 species) |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (23 PDB entries) |
![]() | Domain d2f7oa1: 2f7o A:412-522 [133092] Other proteins in same PDB: d2f7oa2, d2f7oa3 automatically matched to d1htya1 complexed with mpd, msn, nag, po4, zn |
PDB Entry: 2f7o (more details), 1.43 Å
SCOP Domain Sequences for d2f7oa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f7oa1 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs
Timeline for d2f7oa1: