Lineage for d2f67b_ (2f67 B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358101Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (4 families) (S)
    there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members
  5. 1358102Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)
  6. 1358103Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
    class II N-deoxyribosyltransferase
  7. 1358109Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [142064] (5 PDB entries)
    Uniprot Q57VC7 1-152
  8. 1358115Domain d2f67b_: 2f67 B: [133034]
    automated match to d2a0ka1
    complexed with 12b, gol, so4

Details for d2f67b_

PDB Entry: 2f67 (more details), 1.6 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.6 a resolution with benzo[cd]indol-2(1h)-one bound
PDB Compounds: (B:) nucleoside 2-deoxyribosyltransferase

SCOPe Domain Sequences for d2f67b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f67b_ c.23.14.1 (B:) Nucleoside 2-deoxyribosyltransferase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
hhhhhhmrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkni
qmikdcdaviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkd
nlrvegfglpfnlmlydgvevfdsfesafkyflanfps

SCOPe Domain Coordinates for d2f67b_:

Click to download the PDB-style file with coordinates for d2f67b_.
(The format of our PDB-style files is described here.)

Timeline for d2f67b_: