SCOP 1.73: Domain d2f67b1: 2f67 B:9-160

Lineage for d2f67b1 (2f67 B:9-160)

1. Root: SCOP 1.73

2. Class c: Alpha and beta proteins (a/b) [51349] (141 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.14: N-(deoxy)ribosyltransferase-like [52309] (3 families)
   there are similar active site architectures as well as the catalytic mechanisms of functionally characterised members

5. Family c.23.14.1: N-deoxyribosyltransferase [52310] (2 proteins)

6. Protein Nucleoside 2-deoxyribosyltransferase [52311] (2 species)
   class II N-deoxyribosyltransferase

7. Species Trypanosoma brucei [TaxId:5691] [142064] (5 PDB entries)

8. Domain d2f67b1: 2f67 B:9-160 [133034]
   automatically matched to 2A0K A:9-160
   complexed with 12b, gol, so4

Details for d2f67b1

PDB Entry: 2f67, 1.6 Å

PDB Description: crystal structure of nucleoside 2-deoxyribosyltransferase from trypanosoma brucei at 1.6 a resolution with benzo[cd]indol-2(1h)-one bound

PDB Compounds: (B:) nucleoside 2-deoxyribosyltransferase

SCOP Domain Sequences for d2f67b1:

Sequence; same for both SEQRES and ATOM records:

>d2f67b1 c.23.14.1 (B:9-160) Nucleoside 2-deoxyribosyltransferase {Trypanosoma brucei [TaxId: 5691]}
mrkiyiagpavfnpdmgasyynkvrellkkenvmpliptdneatealdirqkniqmikdc
daviadlspfrghepdcgtafevgcaaalnkmvltftsdrrnmrekygsgvdkdnlrveg
fglpfnlmlydgvevfdsfesafkyflanfps

Timeline for d2f67b1:

• d2f67b1 is new in SCOP 1.73
  
• d2f67b1 appears in SCOP 1.75
  
• d2f67b1 appears in the current release, SCOPe 2.08, called d2f67b2