Lineage for d2f5kb_ (2f5k B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2785033Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. 2785199Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. 2785200Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species)
    MORF-related gene 15 isoform 1
  7. 2785201Species Human (Homo sapiens) [TaxId:9606] [141226] (1 PDB entry)
    Uniprot Q9UBU8 6-88
  8. 2785203Domain d2f5kb_: 2f5k B: [132996]
    automated match to d2efia1

Details for d2f5kb_

PDB Entry: 2f5k (more details), 2.2 Å

PDB Description: crystal structure of the chromo domain of human mrg15
PDB Compounds: (B:) Mortality factor 4-like protein 1

SCOPe Domain Sequences for d2f5kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5kb_ b.34.13.3 (B:) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
dpkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlky
vdtnlqkqrelqkanqeqyaegkmr

SCOPe Domain Coordinates for d2f5kb_:

Click to download the PDB-style file with coordinates for d2f5kb_.
(The format of our PDB-style files is described here.)

Timeline for d2f5kb_: