Lineage for d2f5kc_ (2f5k C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. Superfamily b.34.13: Chromo domain-like [54160] (4 families) (S)
    SH3-like barrel is capped by a C-terminal helix
  5. Family b.34.13.3: Chromo barrel domain [117157] (4 proteins)
    typical SH3-like barrel fold; similar sequence motif to the canonical chromo domain
  6. Protein Mortality factor 4-like protein 1, MRG15 [141225] (1 species)
    MORF-related gene 15 isoform 1
  7. Species Human (Homo sapiens) [TaxId:9606] [141226] (1 PDB entry)
    Uniprot Q9UBU8 6-88
  8. Domain d2f5kc_: 2f5k C: [132997]
    automated match to d2efia1

Details for d2f5kc_

PDB Entry: 2f5k (more details), 2.2 Å

PDB Description: crystal structure of the chromo domain of human mrg15
PDB Compounds: (C:) Mortality factor 4-like protein 1

SCOPe Domain Sequences for d2f5kc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5kc_ b.34.13.3 (C:) Mortality factor 4-like protein 1, MRG15 {Human (Homo sapiens) [TaxId: 9606]}
pkpkfqegervlcfhgpllyeakcvkvaikdkqvkyfihysgwnknwdewvpesrvlkyv
dtnlqkqrelqkanqeqyae

SCOPe Domain Coordinates for d2f5kc_ are not available.

Timeline for d2f5kc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f5ka1, d2f5kb_, d2f5kd_, d2f5ke_, d2f5kf_