![]() | Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
![]() | Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
![]() | Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) ![]() |
![]() | Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins) |
![]() | Protein automated matches [190241] (13 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187321] (11 PDB entries) |
![]() | Domain d2f5ib_: 2f5i B: [132994] Other proteins in same PDB: d2f5ia1 automated match to d2b3ua1 |
PDB Entry: 2f5i (more details), 2.3 Å
SCOPe Domain Sequences for d2f5ib_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5ib_ d.108.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} kfvirpataadcsdilrlikelakyeymeeqviltekdlledgfgehpfyhclvaevpke hwtpeghsivgfamyyftydpwigkllyledffvmsdyrgfgigseilknlsqvamrcrc ssmhflvaewnepsinfykrrgasdlsseegwrlfkidkeyllkmate
Timeline for d2f5ib_: