Lineage for d2f5gb_ (2f5g B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2956175Superfamily d.58.57: Transposase IS200-like [143422] (1 family) (S)
    contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer
    automatically mapped to Pfam PF01797
  5. 2956176Family d.58.57.1: Transposase IS200-like [143423] (4 proteins)
    Pfam PF01797
  6. 2956200Protein automated matches [190624] (2 species)
    not a true protein
  7. 2956201Species Sulfolobus solfataricus [TaxId:2287] [187685] (2 PDB entries)
  8. 2956203Domain d2f5gb_: 2f5g B: [132992]
    automated match to d2f4fa1

Details for d2f5gb_

PDB Entry: 2f5g (more details), 1.7 Å

PDB Description: Crystal structure of IS200 transposase
PDB Compounds: (B:) Transposase, putative

SCOPe Domain Sequences for d2f5gb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f5gb_ d.58.57.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]}
elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi
hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky
ieeqwrkege

SCOPe Domain Coordinates for d2f5gb_:

Click to download the PDB-style file with coordinates for d2f5gb_.
(The format of our PDB-style files is described here.)

Timeline for d2f5gb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f5ga_