Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.57: Transposase IS200-like [143422] (1 family) contains extra N-terminal hairpin and C-terminal helix, both are involved in dimerization; there can be helix-swapping in the dimer automatically mapped to Pfam PF01797 |
Family d.58.57.1: Transposase IS200-like [143423] (4 proteins) Pfam PF01797 |
Protein automated matches [190624] (2 species) not a true protein |
Species Sulfolobus solfataricus [TaxId:2287] [187685] (2 PDB entries) |
Domain d2f5gb_: 2f5g B: [132992] automated match to d2f4fa1 |
PDB Entry: 2f5g (more details), 1.7 Å
SCOPe Domain Sequences for d2f5gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f5gb_ d.58.57.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 2287]} elkstrhtkylcnyhfvwipkhrrntlvneiaeytkevlksiaeelgceiialevmpdhi hlfvncppryapsylanyfkgksarlilkkfpqlnkgklwtrsyfvatagnvssevikky ieeqwrkege
Timeline for d2f5gb_: