SCOPe 2.03: Domain d2f5fa1: 2f5f A:4-62

Lineage for d2f5fa1 (2f5f A:4-62)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.24: Iron-dependent repressor protein [46882] (4 proteins)
   automatically mapped to Pfam PF01325

6. Protein Manganese transport regulator MntR [88986] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries)

8. Domain d2f5fa1: 2f5f A:4-62 [132987]
   Other proteins in same PDB: d2f5fa2, d2f5fb2
   automated match to d1on1a1
   complexed with mn

Details for d2f5fa1

PDB Entry: 2f5f, 2.4 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to manganese, AC conformation, pH 8.5

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2f5fa1:

Sequence; same for both SEQRES and ATOM records:

>d2f5fa1 a.4.5.24 (A:4-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
psmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl

Timeline for d2f5fa1:

• d2f5fa1 first appeared in SCOP 1.73
  
• d2f5fa1 appears in SCOPe 2.02
  
• d2f5fa1 appears in SCOPe 2.04
  
• d2f5fa1 appears in the current release, SCOPe 2.08