Class a: All alpha proteins [46456] (284 folds) |
Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) contains a small beta-sheet (wing) |
Family a.4.5.24: Iron-dependent repressor protein [46882] (3 proteins) |
Protein Manganese transport regulator MntR [88986] (1 species) |
Species Bacillus subtilis [TaxId:1423] [88987] (11 PDB entries) |
Domain d2f5da1: 2f5d A:3-62 [132979] Other proteins in same PDB: d2f5da2, d2f5db2 automatically matched to d1on1a1 complexed with mn |
PDB Entry: 2f5d (more details), 1.9 Å
SCOPe Domain Sequences for d2f5da1:
Sequence, based on SEQRES records: (download)
>d2f5da1 a.4.5.24 (A:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyekyrglvl
>d2f5da1 a.4.5.24 (A:3-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tpsmedyieqiymlieekgyarvsdiaealavhpssvtkmvqkldkdeyliyglvl
Timeline for d2f5da1: