Lineage for d2f4vp1 (2f4v P:1-83)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1408886Fold d.27: Ribosomal protein S16 [54564] (1 superfamily)
    beta(4)-alpha-beta; 2 layers: alpha/beta; mixed beta-sheet, order: 51234
  4. 1408887Superfamily d.27.1: Ribosomal protein S16 [54565] (1 family) (S)
  5. 1408888Family d.27.1.1: Ribosomal protein S16 [54566] (1 protein)
  6. 1408889Protein Ribosomal protein S16 [54567] (3 species)
  7. 1408919Species Thermus thermophilus [TaxId:274] [54568] (37 PDB entries)
    Uniprot P80379
  8. 1408945Domain d2f4vp1: 2f4v P:1-83 [132953]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vj1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1emwa_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vp1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (P:) 30S ribosomal protein S16

SCOPe Domain Sequences for d2f4vp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vp1 d.27.1.1 (P:1-83) Ribosomal protein S16 {Thermus thermophilus [TaxId: 274]}
mvkirlarfgskhnphyrivvtdarrkrdgkyiekigyydprkttpdwlkvdverarywl
svgaqptdtarrllrqagvfrqe

SCOPe Domain Coordinates for d2f4vp1:

Click to download the PDB-style file with coordinates for d2f4vp1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vp1: