Lineage for d2f4vj1 (2f4v J:3-100)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1413688Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1416900Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) (S)
    automatically mapped to Pfam PF00338
  5. 1416901Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein)
  6. 1416902Protein Ribosomal protein S10 [55001] (2 species)
  7. 1416928Species Thermus thermophilus [TaxId:274] [55002] (45 PDB entries)
    Uniprot P80375
  8. 1416961Domain d2f4vj1: 2f4v J:3-100 [132947]
    Other proteins in same PDB: d2f4vb1, d2f4vc1, d2f4vc2, d2f4vd1, d2f4ve1, d2f4ve2, d2f4vf1, d2f4vg1, d2f4vh1, d2f4vi1, d2f4vk1, d2f4vl1, d2f4vm1, d2f4vn1, d2f4vo1, d2f4vp1, d2f4vq1, d2f4vr1, d2f4vs1, d2f4vt1
    automatically matched to d1fjgj_
    complexed with ab9, d2c, k, mg, zn

Details for d2f4vj1

PDB Entry: 2f4v (more details), 3.8 Å

PDB Description: 30S ribosome + designer antibiotic
PDB Compounds: (J:) 30S ribosomal protein S10

SCOPe Domain Sequences for d2f4vj1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f4vj1 d.58.15.1 (J:3-100) Ribosomal protein S10 {Thermus thermophilus [TaxId: 274]}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt

SCOPe Domain Coordinates for d2f4vj1:

Click to download the PDB-style file with coordinates for d2f4vj1.
(The format of our PDB-style files is described here.)

Timeline for d2f4vj1: