| Class a: All alpha proteins [46456] (285 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.1: SAM/Pointed domain [47769] (4 families) ![]() |
| Family a.60.1.2: SAM (sterile alpha motif) domain [47773] (16 proteins) |
| Protein Sh3 and multiple ankyrin repeat domains 3 (Shank3) [140616] (1 species) |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [140617] (2 PDB entries) Uniprot Q9JLU4 1749-1815 |
| Domain d2f44a_: 2f44 A: [132911] automated match to d2f3na1 complexed with cl, zn |
PDB Entry: 2f44 (more details), 2.4 Å
SCOPe Domain Sequences for d2f44a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f44a_ a.60.1.2 (A:) Sh3 and multiple ankyrin repeat domains 3 (Shank3) {Norway rat (Rattus norvegicus) [TaxId: 10116]}
mlqlwskfdvgdwlesihlgehrdrfedheiegahlpaltkedfvelgvtrvghrenier
alrql
Timeline for d2f44a_: