Lineage for d2f41c_ (2f41 C:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins)
  6. Protein Transcription factor FapR, C-terminal domain [143184] (1 species)
  7. Species Bacillus subtilis [TaxId:1423] [143185] (2 PDB entries)
    Uniprot O34835 66-186! Uniprot O34835 73-183
  8. Domain d2f41c_: 2f41 C: [132906]
    automated match to d2f3xa1

Details for d2f41c_

PDB Entry: 2f41 (more details), 2.5 Å

PDB Description: Crystal structure of FapR- a global regulator of fatty acid biosynthesis in B. subtilis
PDB Compounds: (C:) Transcription factor fapR

SCOPe Domain Sequences for d2f41c_:

Sequence, based on SEQRES records: (download)

>d2f41c_ d.38.1.5 (C:) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
evigeiidlelddqaisileikqehvfsrnqiarghhlfaqanslavaviddelaltasa
dirftrqvkqgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyr

Sequence, based on observed residues (ATOM records): (download)

>d2f41c_ d.38.1.5 (C:) Transcription factor FapR, C-terminal domain {Bacillus subtilis [TaxId: 1423]}
evigeiidlelddqaisileikqehvarghhlfaqanslavavilaltasadirftrqvk
qgervvakakvtavekekgrtvvevnsyvgeeivfsgrfdmyr

SCOPe Domain Coordinates for d2f41c_ are not available.

Timeline for d2f41c_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2f41a1, d2f41b_, d2f41d_