Lineage for d2f3mf1 (2f3m F:85-217)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 769705Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 769706Superfamily a.45.1: GST C-terminal domain-like [47616] (2 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 769707Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (18 proteins)
  6. 769870Protein Class mu GST [81348] (3 species)
  7. 769878Species Human (Homo sapiens) [TaxId:9606] [47622] (15 PDB entries)
    Uniprot P09488 P28161
  8. 769917Domain d2f3mf1: 2f3m F:85-217 [132883]
    Other proteins in same PDB: d2f3ma2, d2f3mb2, d2f3mc2, d2f3md2, d2f3me2, d2f3mf2
    automatically matched to d1gtua1
    complexed with gtd

Details for d2f3mf1

PDB Entry: 2f3m (more details), 2.7 Å

PDB Description: structure of human glutathione s-transferase m1a-1a complexed with 1- (s-(glutathionyl)-2,4,6-trinitrocyclohexadienate anion
PDB Compounds: (F:) Glutathione S-transferase Mu 1

SCOP Domain Sequences for d2f3mf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f3mf1 a.45.1.1 (F:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

SCOP Domain Coordinates for d2f3mf1:

Click to download the PDB-style file with coordinates for d2f3mf1.
(The format of our PDB-style files is described here.)

Timeline for d2f3mf1: