SCOPe 2.03: Domain d2f2cb_: 2f2c B:

Lineage for d2f2cb_ (2f2c B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Cyclin-dependent PK, CDK6 [88859] (1 species)
   CMGC group; CDKs subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [88860] (11 PDB entries)

8. Domain d2f2cb_: 2f2c B: [132807]
   Other proteins in same PDB: d2f2ca1, d2f2ca2
   automated match to d1blxa_
   complexed with ap9, dms, so4

Details for d2f2cb_

PDB Entry: 2f2c, 2.8 Å

PDB Description: x-ray structure of human cdk6-vcyclinwith the inhibitor aminopurvalanol

PDB Compounds: (B:) cell division protein kinase 6

SCOPe Domain Sequences for d2f2cb_:

Sequence, based on SEQRES records:

>d2f2cb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
adqqyecvaeigegaygkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhl
etfehpnvvrlfdvctvsrtdretkltlvfehvdqdlttyldkvpepgvptetikdmmfq
llrgldflhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrap
evllqssyatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwprdva
lprqafhsksaqpiekfvtdidelgkdlllkcltfnpakrisaysalshpyfqdler

Sequence, based on observed residues (ATOM records):

>d2f2cb_ d.144.1.7 (B:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]}
adqqyecaeiggkvfkardlknggrfvalkrvrvqtgeegmplstirevavlrhletfeh
pnvvrlfdvctvstdretkltlvfehvdqdlttyldkvpepgvptetikdmmfqllrgld
flhshrvvhrdlkpqnilvtssgqikladfglariysfqmaltsvvvtlwyrapevllqs
syatpvdlwsvgcifaemfrrkplfrgssdvdqlgkildviglpgeedwpqafaqpiekf
vtdidelgkdlllkcltfnpakrisaysalshpyfqdler

Timeline for d2f2cb_:

• d2f2cb_ first appeared in SCOP 1.73, called d2f2cb1
  
• d2f2cb_ appears in SCOPe 2.02
  
• d2f2cb_ appears in SCOPe 2.04
  
• d2f2cb_ appears in the current release, SCOPe 2.08