SCOPe 2.03: Domain d2f2ca1: 2f2c A:8-148

Lineage for d2f2ca1 (2f2c A:8-148)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.74: Cyclin-like [47953] (1 superfamily)
   core: 5 helices; one helix is surrounded by the others

4. Superfamily a.74.1: Cyclin-like [47954] (4 families)
   duplication: consists of two domains of this fold

5. Family a.74.1.1: Cyclin [47955] (9 proteins)

6. Protein Viral cyclin [47961] (3 species)

7. Species Herpesvirus saimiri [TaxId:10381] [47962] (5 PDB entries)

8. Domain d2f2ca1: 2f2c A:8-148 [132805]
   Other proteins in same PDB: d2f2cb_
   automated match to d1jowa1
   complexed with ap9, dms, so4

Details for d2f2ca1

PDB Entry: 2f2c, 2.8 Å

PDB Description: x-ray structure of human cdk6-vcyclinwith the inhibitor aminopurvalanol

PDB Compounds: (A:) cyclin homolog

SCOPe Domain Sequences for d2f2ca1:

Sequence, based on SEQRES records:

>d2f2ca1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylscdcf
tnlelinqekdilealkwdte

Sequence, based on observed residues (ATOM records):

>d2f2ca1 a.74.1.1 (A:8-148) Viral cyclin {Herpesvirus saimiri [TaxId: 10381]}
lnrakidsttmkdprvlnnlklrelllpkftslweiqtevtvdnrtilltwmhllcesfe
ldksvfplsvsildrylckkqgtkktlqkigaacvligskirtvkpmtvskltylsftnl
elinqekdilealkwdte

Timeline for d2f2ca1:

• d2f2ca1 first appeared in SCOP 1.73
  
• d2f2ca1 appears in SCOPe 2.02
  
• d2f2ca1 appears in SCOPe 2.04
  
• d2f2ca1 appears in the current release, SCOPe 2.08