![]() | Class a: All alpha proteins [46456] (258 folds) |
![]() | Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies) not a true fold |
![]() | Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) ![]() |
![]() | Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein) Pfam PF02686 |
![]() | Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (1 species) |
![]() | Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries) |
![]() | Domain d2f2ac1: 2f2a C:3-94 [132804] Other proteins in same PDB: d2f2aa1, d2f2ab1, d2f2ab2 automatically matched to 2DF4 C:2-100 complexed with gln, mg |
PDB Entry: 2f2a (more details), 2.3 Å
SCOP Domain Sequences for d2f2ac1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f2ac1 a.137.12.1 (C:3-94) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]} kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv lredkaikgipqelalknaketedgqfkvpti
Timeline for d2f2ac1: