SCOP 1.73: Domain d2f2ac1: 2f2a C:3-94

Lineage for d2f2ac1 (2f2a C:3-94)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (12 superfamilies)
   not a true fold

4. Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family)

5. Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
   Pfam PF02686

6. Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (1 species)

7. Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)

8. Domain d2f2ac1: 2f2a C:3-94 [132804]
   Other proteins in same PDB: d2f2aa1, d2f2ab1, d2f2ab2
   automatically matched to 2DF4 C:2-100
   complexed with gln, mg

Details for d2f2ac1

PDB Entry: 2f2a, 2.3 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Gln

PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOP Domain Sequences for d2f2ac1:

Sequence; same for both SEQRES and ATOM records:

>d2f2ac1 a.137.12.1 (C:3-94) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvpti

Timeline for d2f2ac1:

• d2f2ac1 is new in SCOP 1.73
  
• d2f2ac1 appears in SCOP 1.75
  
• d2f2ac1 appears in the current release, SCOPe 2.08, called d2f2ac_