Lineage for d2f2ac_ (2f2a C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2733644Fold a.137: Non-globular all-alpha subunits of globular proteins [48661] (14 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 2734134Superfamily a.137.12: Glu-tRNAGln amidotransferase C subunit [141000] (1 family) (S)
  5. 2734135Family a.137.12.1: Glu-tRNAGln amidotransferase C subunit [141001] (1 protein)
    Pfam PF02686
  6. 2734136Protein Glu-tRNAGln amidotransferase C subunit, GatC [141002] (2 species)
  7. 2734137Species Staphylococcus aureus [TaxId:1280] [141003] (5 PDB entries)
    Uniprot P68807 2-100
  8. 2734138Domain d2f2ac_: 2f2a C: [132804]
    Other proteins in same PDB: d2f2aa_, d2f2ab1, d2f2ab2
    automated match to d2df4c1
    protein/RNA complex; complexed with gln, mg

Details for d2f2ac_

PDB Entry: 2f2a (more details), 2.3 Å

PDB Description: Structure of tRNA-Dependent Amidotransferase GatCAB complexed with Gln
PDB Compounds: (C:) Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit C

SCOPe Domain Sequences for d2f2ac_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2f2ac_ a.137.12.1 (C:) Glu-tRNAGln amidotransferase C subunit, GatC {Staphylococcus aureus [TaxId: 1280]}
kvtreevehianlarlqispeeteemantlesildfakqndsadtegveptyhvldlqnv
lredkaikgipqelalknaketedgqfkvpti

SCOPe Domain Coordinates for d2f2ac_:

Click to download the PDB-style file with coordinates for d2f2ac_.
(The format of our PDB-style files is described here.)

Timeline for d2f2ac_: