SCOPe 2.08: Domain d2f23a2: 2f23 A:78-156

Lineage for d2f23a2 (2f23 A:78-156)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein)
   automatically mapped to Pfam PF01272

6. Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species)
   N-terminal domain is a long alpha-hairpin

7. Species Thermus thermophilus [TaxId:274] [143118] (2 PDB entries)
   Uniprot Q5SJG6 78-156! Uniprot Q72JT8 78-156

8. Domain d2f23a2: 2f23 A:78-156 [132798]
   Other proteins in same PDB: d2f23a1, d2f23b1

Details for d2f23a2

PDB Entry: 2f23, 1.6 Å

PDB Description: Crystal structure of GreA factor homolog 1 (Gfh1) protein of Thermus thermophilus

PDB Compounds: (A:) anti-cleavage anti-GreA transcription factor Gfh1

SCOPe Domain Sequences for d2f23a2:

Sequence; same for both SEQRES and ATOM records:

>d2f23a2 d.26.1.2 (A:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]}
gsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisdaspmgkallghrvgdv
lsldtpkgkrefrvvaihg

Timeline for d2f23a2:

• d2f23a2 first appeared in SCOP 1.73
  
• d2f23a2 appears in SCOPe 2.07