![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.26: FKBP-like [54533] (3 superfamilies) core: beta(2)-alpha-beta(2); antiparallel beta-sheet |
![]() | Superfamily d.26.1: FKBP-like [54534] (4 families) ![]() |
![]() | Family d.26.1.2: GreA transcript cleavage factor, C-terminal domain [54549] (1 protein) automatically mapped to Pfam PF01272 |
![]() | Protein GreA transcript cleavage factor, C-terminal domain [54550] (3 species) N-terminal domain is a long alpha-hairpin |
![]() | Species Thermus thermophilus [TaxId:274] [143118] (2 PDB entries) Uniprot Q5SJG6 78-156! Uniprot Q72JT8 78-156 |
![]() | Domain d2f23b2: 2f23 B:78-156 [132800] Other proteins in same PDB: d2f23a1, d2f23b1 automated match to d2f23a2 |
PDB Entry: 2f23 (more details), 1.6 Å
SCOPe Domain Sequences for d2f23b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2f23b2 d.26.1.2 (B:78-156) GreA transcript cleavage factor, C-terminal domain {Thermus thermophilus [TaxId: 274]} gsgeviglgsvveledplsgerlsvqvvspaeanvldtpmkisdaspmgkallghrvgdv lsldtpkgkrefrvvaihg
Timeline for d2f23b2: