SCOP 1.73: Domain d2f0ad1: 2f0a D:251-342

Lineage for d2f0ad1 (2f0a D:251-342)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (4 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (46 proteins)
   Pfam PF00595

6. Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (2 species)

7. Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries)

8. Domain d2f0ad1: 2f0a D:251-342 [132664]
   automatically matched to d1l6oa_
   complexed with co, so4

Details for d2f0ad1

PDB Entry: 2f0a, 1.8 Å

PDB Description: crystal structure of monomeric uncomplexed form of xenopus dishevelled pdz domain

PDB Compounds: (D:) Segment polarity protein dishevelled homolog DVL-2

SCOP Domain Sequences for d2f0ad1:

Sequence, based on SEQRES records:

>d2f0ad1 b.36.1.1 (D:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakle

Sequence, based on observed residues (ATOM records):

>d2f0ad1 b.36.1.1 (D:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqgiyigsimkggavaadgriepgdmllqvndinfenmsn
ddavrvlrdivhkpivltvakle

Timeline for d2f0ad1:

• d2f0ad1 is new in SCOP 1.73
  
• d2f0ad1 appears in SCOP 1.75
  
• d2f0ad1 appears in the current release, SCOPe 2.08, called d2f0ad2