Lineage for d2f0ab2 (2f0a B:251-342)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395674Protein Segment polarity protein dishevelled homolog Dvl-2 [89313] (3 species)
  7. 2395675Species African clawed frog (Xenopus laevis) [TaxId:8355] [89314] (2 PDB entries)
  8. 2395677Domain d2f0ab2: 2f0a B:251-342 [132662]
    Other proteins in same PDB: d2f0aa3, d2f0ab3, d2f0ad3
    automated match to d1l6oa_
    complexed with co, so4

Details for d2f0ab2

PDB Entry: 2f0a (more details), 1.8 Å

PDB Description: crystal structure of monomeric uncomplexed form of xenopus dishevelled pdz domain
PDB Compounds: (B:) Segment polarity protein dishevelled homolog DVL-2

SCOPe Domain Sequences for d2f0ab2:

Sequence, based on SEQRES records: (download)

>d2f0ab2 b.36.1.1 (B:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsnergdggiyigsimkggavaadgriepgdmllqvndi
nfenmsnddavrvlrdivhkpgpivltvakle

Sequence, based on observed residues (ATOM records): (download)

>d2f0ab2 b.36.1.1 (B:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]}
miitvtlnmekynflgisivgqsgiyigsimkggavaadgriepgdmllqvndinfenms
nddavrvlrdivhkppivltvakle

SCOPe Domain Coordinates for d2f0ab2:

Click to download the PDB-style file with coordinates for d2f0ab2.
(The format of our PDB-style files is described here.)

Timeline for d2f0ab2: