SCOPe 2.08: Domain d2ezub2: 2ezu B:9-182

Lineage for d2ezub2 (2ezu B:9-182)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.0: automated matches [227300] (1 protein)
   not a true family

6. Protein automated matches [227126] (21 species)
   not a true protein

7. Species Lactobacillus plantarum [TaxId:1590] [254973] (7 PDB entries)

8. Domain d2ezub2: 2ezu B:9-182 [132643]
   Other proteins in same PDB: d2ezua1, d2ezub1
   automated match to d2ezua2
   complexed with fad, htl, mg, na, pyr

Details for d2ezub2

PDB Entry: 2ezu, 2.16 Å

PDB Description: pyruvate oxidase variant f479w in complex with reaction intermediate 2-acetyl-thiamin diphosphate

PDB Compounds: (B:) Pyruvate oxidase

SCOPe Domain Sequences for d2ezub2:

Sequence; same for both SEQRES and ATOM records:

>d2ezub2 c.36.1.0 (B:9-182) automated matches {Lactobacillus plantarum [TaxId: 1590]}
tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdtfqemnenp
iyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedw

Timeline for d2ezub2:

• d2ezub2 first appeared in SCOP 1.73
  
• d2ezub2 appears in SCOPe 2.07