Class b: All beta proteins [48724] (174 folds) |
Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) |
Family b.34.2.1: SH3-domain [50045] (40 proteins) |
Protein C-Crk, N-terminal SH3 domain [50046] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [50047] (9 PDB entries) |
Domain d2eywa1: 2eyw A:134-190 [132603] automatically matched to d1m3ca_ |
PDB Entry: 2eyw (more details)
SCOPe Domain Sequences for d2eywa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2eywa1 b.34.2.1 (A:134-190) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} aeyvralfdfngndeedlpfkkgdilrirdkpeeqwwnaedsegkrgmipvpyveky
Timeline for d2eywa1: