Lineage for d2exkd2 (2exk D:3-324)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2416839Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies)
    consists of five 4-stranded beta-sheet motifs; meander
  4. 2416849Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) (S)
  5. 2416850Family b.67.2.1: alpha-L-arabinanase-like [75006] (5 proteins)
    automatically mapped to Pfam PF04616
  6. 2416864Protein Beta-D-xylosidase N-terminal domain [141538] (4 species)
  7. 2416882Species Geobacillus stearothermophilus [TaxId:1422] [141539] (4 PDB entries)
    Uniprot Q68HB3 3-324
  8. 2416894Domain d2exkd2: 2exk D:3-324 [132558]
    Other proteins in same PDB: d2exka1, d2exkb1, d2exkc1, d2exkd1
    automated match to d2exka2
    complexed with ca, gol, mes, xys

Details for d2exkd2

PDB Entry: 2exk (more details), 2.2 Å

PDB Description: structure of the family43 beta-xylosidase e187g from geobacillus stearothermophilus in complex with xylobiose
PDB Compounds: (D:) beta-D-xylosidase

SCOPe Domain Sequences for d2exkd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2exkd2 b.67.2.1 (D:3-324) Beta-D-xylosidase N-terminal domain {Geobacillus stearothermophilus [TaxId: 1422]}
kiknpiltgfhpdpsicrvgddyyiavstfewfpgvriyhskdlknwrlvarplnrlsql
nmignpdsggvwaphlsysdgkfwliytdvkvvegqwkdghnylvtcdtidgawsdpiyl
nssgfdpslfhdedgrkylvnmywdhrvdhhpfygivlqeysveqkklvgepkiifkgtd
lritggphlykingyyylltaeggtrynhaatiarstslygpyevhpdnplltswpyprn
plqkaghasivhthtdewflvhltgrplpregqpllehrgycplgretaiqrlewkdgwp
yvvggngpsleidgpsveevsw

SCOPe Domain Coordinates for d2exkd2:

Click to download the PDB-style file with coordinates for d2exkd2.
(The format of our PDB-style files is described here.)

Timeline for d2exkd2: