Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds) |
Fold e.8: DNA/RNA polymerases [56671] (1 superfamily) divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members |
Superfamily e.8.1: DNA/RNA polymerases [56672] (6 families) "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain |
Family e.8.1.1: DNA polymerase I [56673] (4 proteins) |
Protein phi29 DNA polymerase [118193] (1 species) |
Species Bacteriophage phi-29 [TaxId:10756] [118194] (8 PDB entries) Uniprot P03680 |
Domain d2ex3e2: 2ex3 E:188-575 [132505] Other proteins in same PDB: d2ex3a1, d2ex3b1, d2ex3c1, d2ex3d1, d2ex3e1, d2ex3f1, d2ex3g1, d2ex3h1, d2ex3i1, d2ex3j1, d2ex3k1, d2ex3l1 automatically matched to 2EX3 A:188-575 protein/DNA complex; complexed with pb |
PDB Entry: 2ex3 (more details), 3 Å
SCOPe Domain Sequences for d2ex3e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ex3e2 e.8.1.1 (E:188-575) phi29 DNA polymerase {Bacteriophage phi-29 [TaxId: 10756]} mtagsdslkgfkdiittkkfkkvfptlslgldkevryayrggftwlndrfkekeigegmv fdvnslypaqmysrllpygepivfegkyvwdedyplhiqhircefelkegyiptiqikrs rfykgneylkssggeiadlwlsnvdlelmkehydlynveyisglkfkattglfkdfidkw tyikttsegaikqlaklmlnslygkfasnpdvtgkvpylkengalgfrlgeeetkdpvyt pmgvfitawaryttitaaqacydriiycdtdsihltgteipdvikdivdpkklgywahes tfkrakylrqktyiqdiymkevdgklvegspddytdikfsvkcagmtdkikkevtfenfk vgfsrkmkpkpvqvpggvvlvddtftik
Timeline for d2ex3e2: