Class e: Multi-domain proteins (alpha and beta) [56572] (69 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.3: Dac-like [144040] (3 proteins) Pfam PF02113; D-Ala-D-Ala carboxypeptidase 3 (S13) family; contains a large insertion comprising two subdomains: (d1) aplha+beta with topological similarity to one subunit of the DTD-like family (69501) and (d2) six-stranded beta-sandwich with a crossed-loop topology |
Protein DD-carboxypeptidase DacB [144045] (2 species) Penicillin-binding protein 4 |
Species Escherichia coli [TaxId:562] [144046] (6 PDB entries) Uniprot P24228 22-477 |
Domain d2ex2a1: 2ex2 A:22-477 [132497] complexed with gol |
PDB Entry: 2ex2 (more details), 1.55 Å
SCOPe Domain Sequences for d2ex2a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ex2a1 e.3.1.3 (A:22-477) DD-carboxypeptidase DacB {Escherichia coli [TaxId: 562]} nvdeyitqlpaganlalmvqkvgasapaidyhsqqmalpastqkvitalaaliqlgpdfr ftttletkgnvengvlkgdlvarfgadptlkrqdirnmvatlkksgvnqidgnvlidtsi fashdkapgwpwndmtqcfsappaaaivdrncfsvslysapkpgdmafirvasyypvtmf sqvrtlprgsaeaqyceldvvpgdlnrftltgclpqrseplplafavqdgasyagailky elkqagitwsgtllrqtqvnepgtvvaskqsaplhdllkimlkksdnmiadtvfrmigha rfnvpgtwragsdavrqilrqqagvdigntiiadgsglsrhnliapatmmqvlqyiaqhd nelnfismlplagydgslqyraglhqagvdgkvsaktgslqgvynlagfittasgqrmaf vqylsgyavepadqrnrriplvrfesrlykdiyqnn
Timeline for d2ex2a1: