Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) |
Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins) also known as short-chain dehydrogenases and SDR family parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7 |
Protein (s)-1-phenylethanol dehydrogenase [141902] (1 species) |
Species Azoarcus sp. ebn1 [TaxId:76114] [141903] (2 PDB entries) Uniprot Q5P5I4 3-249 |
Domain d2ew8c1: 2ew8 C:3-249 [132449] automatically matched to 2EW8 A:3-249 complexed with so4 |
PDB Entry: 2ew8 (more details), 2.1 Å
SCOP Domain Sequences for d2ew8c1:
Sequence, based on SEQRES records: (download)
>d2ew8c1 c.2.1.2 (C:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav dggmvrh
>d2ew8c1 c.2.1.2 (C:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai apslvmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh
Timeline for d2ew8c1: