Lineage for d2ew8a1 (2ew8 A:3-249)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 819418Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 819419Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 819736Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 819743Protein (s)-1-phenylethanol dehydrogenase [141902] (1 species)
  7. 819744Species Azoarcus sp. ebn1 [TaxId:76114] [141903] (2 PDB entries)
    Uniprot Q5P5I4 3-249
  8. 819745Domain d2ew8a1: 2ew8 A:3-249 [132447]
    complexed with so4

Details for d2ew8a1

PDB Entry: 2ew8 (more details), 2.1 Å

PDB Description: crystal structure of the (s)-specific 1-phenylethanol dehydrogenase of the denitrifying bacterium strain ebn1
PDB Compounds: (A:) (S)-1-Phenylethanol dehydrogenase

SCOP Domain Sequences for d2ew8a1:

Sequence, based on SEQRES records: (download)

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvrtatteasalsamfdvlpnmlqaiprlqvpldltgaaaflasddasfitgqtlav
dggmvrh

Sequence, based on observed residues (ATOM records): (download)

>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]}
qrlkdklavitggangigraiaerfavegadiaiadlvpapeaeaairnlgrrvltvkcd
vsqpgdveafgkqvistfgrcdilvnnagiyplipfdeltfeqwkktfeinvdsgflmak
afvpgmkrngwgriinltsttywlkieaythyistkaanigftralasdlgkdgitvnai
apslvnmlqaiprlqvpldltgaaaflasddasfitgqtlavdggmvrh

SCOP Domain Coordinates for d2ew8a1:

Click to download the PDB-style file with coordinates for d2ew8a1.
(The format of our PDB-style files is described here.)

Timeline for d2ew8a1: