![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily) 6 helices, homodimer of 3-helical domains |
![]() | Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families) ![]() automatically mapped to Pfam PF02742 |
![]() | Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins) |
![]() | Protein Manganese transport regulator MntR [89086] (1 species) |
![]() | Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries) |
![]() | Domain d2ev5a2: 2ev5 A:63-138 [132418] Other proteins in same PDB: d2ev5a1, d2ev5b1 automated match to d1on1a2 complexed with ca |
PDB Entry: 2ev5 (more details), 2 Å
SCOPe Domain Sequences for d2ev5a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ev5a2 a.76.1.1 (A:63-138) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee ddarkkdlksiqkkte
Timeline for d2ev5a2: