SCOPe 2.08: Domain d2ev5a2: 2ev5 A:63-138

Lineage for d2ev5a2 (2ev5 A:63-138)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.76: Iron-dependent repressor protein, dimerization domain [47978] (1 superfamily)
   6 helices, homodimer of 3-helical domains

4. Superfamily a.76.1: Iron-dependent repressor protein, dimerization domain [47979] (2 families)
   automatically mapped to Pfam PF02742

5. Family a.76.1.1: Iron-dependent repressor protein, dimerization domain [47980] (4 proteins)

6. Protein Manganese transport regulator MntR [89086] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [89087] (11 PDB entries)

8. Domain d2ev5a2: 2ev5 A:63-138 [132418]
   Other proteins in same PDB: d2ev5a1, d2ev5b1
   automated match to d1on1a2
   complexed with ca

Details for d2ev5a2

PDB Entry: 2ev5, 2 Å

PDB Description: Bacillus subtilis manganese transport regulator (MNTR) bound to calcium

PDB Compounds: (A:) Transcriptional regulator mntR

SCOPe Domain Sequences for d2ev5a2:

Sequence; same for both SEQRES and ATOM records:

>d2ev5a2 a.76.1.1 (A:63-138) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]}
tskgkkigkrlvyrhelleqflriigvdeekiyndvegiehhlswnsidrigdlvqyfee
ddarkkdlksiqkkte

Timeline for d2ev5a2:

• d2ev5a2 first appeared in SCOP 1.73
  
• d2ev5a2 appears in SCOPe 2.07