Class a: All alpha proteins [46456] (284 folds) |
Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily) multihelical; 2 layers or orthogonally packed helices |
Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family) |
Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins) |
Protein Glycolipid transfer protein, GLTP [110006] (2 species) |
Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries) Uniprot Q9NZD2 |
Domain d2euma_: 2eum A: [132400] automated match to d1sx6a_ complexed with d10, lat, oca, oct, sph |
PDB Entry: 2eum (more details), 2.3 Å
SCOPe Domain Sequences for d2euma_:
Sequence, based on SEQRES records: (download)
>d2euma_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]} laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf lvnytatidviyemytqmnaelnykv
>d2euma_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]} laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskqnvteeeclekirlfl vnytatidviyemytqmnaelnykv
Timeline for d2euma_: