SCOPe 2.08: Domain d2euma_: 2eum A:

Lineage for d2euma_ (2eum A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.224: Glycolipid transfer protein, GLTP [110003] (1 superfamily)
   multihelical; 2 layers or orthogonally packed helices

4. Superfamily a.224.1: Glycolipid transfer protein, GLTP [110004] (1 family)

5. Family a.224.1.1: Glycolipid transfer protein, GLTP [110005] (2 proteins)

6. Protein Glycolipid transfer protein, GLTP [110006] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [110007] (20 PDB entries)
   Uniprot Q9NZD2

8. Domain d2euma_: 2eum A: [132400]
   automated match to d1sx6a_
   complexed with d10, oca, oct, sph

Details for d2euma_

PDB Entry: 2eum, 2.3 Å

PDB Description: crystal structure of human glycolipid transfer protein complexed with 8:0 lactosylceramide

PDB Compounds: (A:) glycolipid transfer protein

SCOPe Domain Sequences for d2euma_:

Sequence, based on SEQRES records:

>d2euma_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskgqnvteeeclekirlf
lvnytatidviyemytqmnaelnykv

Sequence, based on observed residues (ATOM records):

>d2euma_ a.224.1.1 (A:) Glycolipid transfer protein, GLTP {Human (Homo sapiens) [TaxId: 9606]}
laehllkplpadkqietgpfleavshlppffdclgspvftpikadisgnitkikavydtn
pakfrtlqnilevekemygaewpkvgatlalmwlkrglrfiqvflqsicdgerdenhpnl
irvnatkayemalkkyhgwivqkifqaalyaapyksdflkalskqnvteeeclekirlfl
vnytatidviyemytqmnaelnykv

Timeline for d2euma_:

• d2euma_ first appeared in SCOP 1.73, called d2euma1
  
• d2euma_ appears in SCOPe 2.07