Lineage for d2euia1 (2eui A:1-153)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533211Family d.108.1.1: N-acetyl transferase, NAT [55730] (58 proteins)
  6. 2533440Protein Probable acetyltransferase PA4026 [143692] (1 species)
  7. 2533441Species Pseudomonas aeruginosa [TaxId:287] [143693] (1 PDB entry)
    Uniprot Q9HX01 1-153
  8. 2533442Domain d2euia1: 2eui A:1-153 [132387]
    Other proteins in same PDB: d2euib_, d2euid_, d2euie_

Details for d2euia1

PDB Entry: 2eui (more details), 2.8 Å

PDB Description: Crystal structure of a probable acetyltransferase
PDB Compounds: (A:) Probable acetyltransferase

SCOPe Domain Sequences for d2euia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euia1 d.108.1.1 (A:1-153) Probable acetyltransferase PA4026 {Pseudomonas aeruginosa [TaxId: 287]}
mrivqatlehldllaplfvkyrefygmlsypessrkflekrlrrkesviylaladeedrl
lgfcqlypsfsslslkrvwilndiyvaeearrqlvadhllqhakqmarethavrmrvsts
vdnevaqkvyesigfredqefknytlpisdels

SCOPe Domain Coordinates for d2euia1:

Click to download the PDB-style file with coordinates for d2euia1.
(The format of our PDB-style files is described here.)

Timeline for d2euia1: