SCOP 1.73: Domain d2euaa1: 2eua A:2-429

Lineage for d2euaa1 (2eua A:2-429)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.161: ADC synthase [56321] (1 superfamily)
   duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets

4. Superfamily d.161.1: ADC synthase [56322] (1 family)
   the active site is formed by additional structures inserted into the core structure

5. Family d.161.1.1: ADC synthase [56323] (5 proteins)

6. Protein Menaquinone-specific isochorismate synthase MenF [143941] (1 species)

7. Species Escherichia coli [TaxId:562] [143942] (1 PDB entry)

8. Domain d2euaa1: 2eua A:2-429 [132380]
   complexed with tar

Details for d2euaa1

PDB Entry: 2eua, 2.5 Å

PDB Description: structure and mechanism of menf, the menaquinone-specific isochorismate synthase from escherichia coli

PDB Compounds: (A:) Menaquinone-specific isochorismate synthase

SCOP Domain Sequences for d2euaa1:

Sequence; same for both SEQRES and ATOM records:

>d2euaa1 d.161.1.1 (A:2-429) Menaquinone-specific isochorismate synthase MenF {Escherichia coli [TaxId: 562]}
qslttalenllrhlsqeipatpgirvidipfplkdafdalswlasqqtypqfywqqrngd
eeavvlgaitrftsldqaqrflrqhpehadlriwglnafdpsqgnlllprlewrrcggka
tlrltlfsesslqhdaiqakefiatlvsikplpglhltttreqhwpdktgwtqlielatk
tiaegeldkvvlaratdlhfaspvnaaammaasrrlnlncyhfymafdgenaflgssper
lwrrrdkalrtealagtvannpddkqaqqlgewlmaddknqrenmlvvedicqrlqadtq
tldvlppqvlrlrkvqhlrrciwtslnkaddviclhqlqptaavaglprdlarqfiarhe
pftrewyagsagylslqqsefcvslrsakisgnvvrlyagagivrgsdpeqewqeidnka
aglrtllq

Timeline for d2euaa1:

• d2euaa1 is new in SCOP 1.73
  
• d2euaa1 appears in SCOP 1.75
  
• d2euaa1 appears in the current release, SCOPe 2.08