Lineage for d2euab1 (2eua B:2-429)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 736993Fold d.161: ADC synthase [56321] (1 superfamily)
    duplication: contains four repeats of alpha-beta(2)-beta motif arranged in a 4 layer core structure: alpha/beta/beta/alpha; orthogonally packed beta-sheets
  4. 736994Superfamily d.161.1: ADC synthase [56322] (1 family) (S)
    the active site is formed by additional structures inserted into the core structure
  5. 736995Family d.161.1.1: ADC synthase [56323] (5 proteins)
  6. 737006Protein Menaquinone-specific isochorismate synthase MenF [143941] (1 species)
  7. 737007Species Escherichia coli [TaxId:562] [143942] (1 PDB entry)
  8. 737009Domain d2euab1: 2eua B:2-429 [132381]
    automatically matched to 2EUA A:2-429
    complexed with tar

Details for d2euab1

PDB Entry: 2eua (more details), 2.5 Å

PDB Description: structure and mechanism of menf, the menaquinone-specific isochorismate synthase from escherichia coli
PDB Compounds: (B:) Menaquinone-specific isochorismate synthase

SCOP Domain Sequences for d2euab1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2euab1 d.161.1.1 (B:2-429) Menaquinone-specific isochorismate synthase MenF {Escherichia coli [TaxId: 562]}
qslttalenllrhlsqeipatpgirvidipfplkdafdalswlasqqtypqfywqqrngd
eeavvlgaitrftsldqaqrflrqhpehadlriwglnafdpsqgnlllprlewrrcggka
tlrltlfsesslqhdaiqakefiatlvsikplpglhltttreqhwpdktgwtqlielatk
tiaegeldkvvlaratdlhfaspvnaaammaasrrlnlncyhfymafdgenaflgssper
lwrrrdkalrtealagtvannpddkqaqqlgewlmaddknqrenmlvvedicqrlqadtq
tldvlppqvlrlrkvqhlrrciwtslnkaddviclhqlqptaavaglprdlarqfiarhe
pftrewyagsagylslqqsefcvslrsakisgnvvrlyagagivrgsdpeqewqeidnka
aglrtllq

SCOP Domain Coordinates for d2euab1:

Click to download the PDB-style file with coordinates for d2euab1.
(The format of our PDB-style files is described here.)

Timeline for d2euab1: